PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013592300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 555aa    MW: 62720.3 Da    PI: 6.1252
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013592300.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix895.4e-2858142187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+ aL+++r++m+ ++r++++k+plWeevs+km e g+ r++k+Ckek+en+ k++k++keg+ ++  ++ +t+++fdqlea
  XP_013592300.1  58 RWPRQETVALLKIRSDMGIAFRDASAKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKYHKRTKEGRTGK--PEGKTYRFFDQLEA 142
                     8********************************************************************95..55568*******85 PP

2trihelix1032.2e-32371456187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k e+ aLi++r+++++++ ++  k+plWee+s+ mr+ gf+r++k+Ckekwen+nk++kk+ke++kkr +++s+tcpyf+ql+a
  XP_013592300.1 371 RWPKVEIEALIKLRTNLDSKYLENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKYFKKVKESNKKR-PQDSKTCPYFHQLDA 456
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.05955117IPR001005SANT/Myb domain
CDDcd122033.18E-2157122No hitNo description
PROSITE profilePS500906.87657115IPR017877Myb-like domain
PfamPF138372.0E-1757143No hitNo description
PROSITE profilePS500907.201364428IPR017877Myb-like domain
SMARTSM007170.0022368430IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-4369427IPR009057Homeodomain-like
PfamPF138373.0E-21370457No hitNo description
CDDcd122031.97E-25370435No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MEFGGGTTTT ASTTSEAPRP PQSNDAAATT EAAAAAATVG AFEVSEEMND RGGFGGNRWP  60
RQETVALLKI RSDMGIAFRD ASAKGPLWEE VSRKMGELGY IRNAKKCKEK FENVYKYHKR  120
TKEGRTGKPE GKTYRFFDQL EALETHHHQQ HQPPQPQTQP PLRPHNNNSS MFSTPPPVTT  180
TIIPPTTTPS FPNISGDFPS DNSTSSSSSY STSSDVDIGG GGRKKKRKRK WKEFFERLMK  240
QVVDKQEELQ RQFLEAVDKR ERERLVREES WRAQEIARIN REREILAQER SMSAAKDSAV  300
MAFLHKFSEK PTVPPQPQPQ VNNNNNQQQT SQTPQTPQPP PPPLPQPALD TAKTDNGDQI  360
MTTPASASSS RWPKVEIEAL IKLRTNLDSK YLENGPKGPL WEEISAGMRR LGFNRNSKRC  420
KEKWENINKY FKKVKESNKK RPQDSKTCPY FHQLDALYRE RNKFQTTTNI NVASSSSTKP  480
DNSVPLMVQP EQQWPPATDH PPPGAPAQPL DQSFDDEEGT DEEDYDDEEE DEENEEEEGE  540
FELVPSNDNK TTNNV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223229KKKRKRK
2224229KKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892031e-111AC189203.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006H21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592300.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-143TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D3D1920.0A0A0D3D192_BRAOL; Uncharacterized protein
STRINGBra015716.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.10.0Trihelix family protein